GRF (ovine, caprine) trifluoroacetate salt
GRF (ovine, caprine) trifluoroacetate salt
Product description
GRF (ovine, caprine) trifluoroacetate salt,CAS :94948-82-0 from ruixi.It is a synthetic peptide, only used for scientific research, not for human body.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 94948-82-0 |
Sequence | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH₂ |
Molecular Formula | C₂₂₁H₃₆₈N₇₂O₆₆S |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product